HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B9Y7X8",
"id": "B9Y7X8_9FIRM",
"source_organism": {
"taxId": "545696",
"scientificName": "Holdemania filiformis DSM 12042",
"fullName": "Holdemania filiformis DSM 12042"
},
"name": "Iron-sulfur cluster carrier protein",
"description": [
"Binds and transfers iron-sulfur (Fe-S) clusters to target apoproteins. Can hydrolyze ATP"
],
"length": 278,
"sequence": "MSETCNHDCGSCSANCASRQEPQSFLEKPNPHSRIRKIIGVVSGKGGVGKSLVTSLLAATMQRRGHQSAVMDADITGPSIPKVFGIHGMAYGNEDGILPAVSSTGIQIMSVNLMLDNEETPVIWRGPILAGMVKQFYGEVIWSDVDFMFVDMPPGTGDVPLTVFQSLPLDGIVVVTSPQELVSMIVAKAVNMANMMNIPVLGVVENMSYLECPDCGKRIEVFGHSKLDEVAAEKGLDILARLPINPQFASLCDAGRIEDFEGEWMTKAAEKLEGLLEK",
"proteome": null,
"gene": "HOLDEFILI_01924",
"go_terms": [
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051536",
"name": "iron-sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0140663",
"name": "ATP-dependent FeS chaperone activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016226",
"name": "iron-sulfur cluster assembly",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "3cbfa3de54076f1e90790dfecfba67c11e53357e",
"counters": {
"domain_architectures": 28831,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"panther": 1,
"hamap": 1,
"pfam": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 28831
}
}
}