GET /api/protein/UniProt/B9TSQ5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B9TSQ5",
        "id": "B9TSQ5_PIG",
        "source_organism": {
            "taxId": "9823",
            "scientificName": "Sus scrofa",
            "fullName": "Sus scrofa (Pig)"
        },
        "name": "Phosphatidylserine lipase ABHD16A",
        "description": [
            "Phosphatidylserine (PS) lipase that mediates the hydrolysis of phosphatidylserine to generate lysophosphatidylserine (LPS). LPS constitutes a class of signaling lipids that regulates immunological and neurological processes. Has no activity towards diacylglycerol, triacylglycerol or lysophosphatidylserine lipase. Also has monoacylglycerol lipase activity, with preference for 1-(9Z,12Z-octadecadienoyl)-glycerol (1-LG) and 2-glyceryl-15-deoxy-Delta(12,14)-prostaglandin J2 (15d-PGJ(2)-G)"
        ],
        "length": 558,
        "sequence": "MAKLLSCVLGPRLYKIYRERDSERAASGVPGTPTSVTTASSSSWDTYYQPRALEKHADSILALASVFWSISYYSSPFAFFYLYRKGYLSLSKVVPFSHYAGTLLLLLAGVACLRGIGRWTNPQYRQFITILEAAHRNQSAENKRQLANYNFDFRSWPVDFHWEEPSSRKGSRGGPSRRGVALLRPEPLHRGTADTLLNRVKKLPCQITSYLVAHTLGRRMLYPGSVYLLQKALMPVLLQGQARLVEECNGRRAKLLACDGNEVDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTPLEAGYSVLGWNHPGFAGSTGVPFPQNEANAMDVVVQFAIHRLGFQPQDIIIYAWSIGGFTATWAAMSYPDISAVILDASFDDLVPLALKVMPDSWRGLVTRTVRQHLNLNNAEQLCRYQGPVLLIRRTKDEIITTTVPEDVMSNRGNDLLLKLLQHRYPRVMAEEGLRVVRQWLEASSQLEEASIYSRWEVEEDWCLSVLRSYQAEHGPEFPWSVGEDMSADGRRQLALFLAQKHLHNFEATHCTPLPAPNFQMPWHL",
        "proteome": null,
        "gene": "BAT5",
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "329fab395b6372eb6f40f272c4c012d5cc319173",
        "counters": {
            "domain_architectures": 1367,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1367
        }
    }
}