GET /api/protein/UniProt/B9S4A1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B9S4A1",
"id": "B9S4A1_RICCO",
"source_organism": {
"taxId": "3988",
"scientificName": "Ricinus communis",
"fullName": "Ricinus communis (Castor bean)"
},
"name": "Alpha-soluble nsf attachment protein, putative",
"description": [
"Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus"
],
"length": 289,
"sequence": "MSDQIAKGEEFEKKAEKKLNGWGLFGSKYEDASDLFDKAANSFKLAKSWDRAGSTYVKLANCHLKLDSKHEAAQAYVDAAHCYKKTTTNEAISCLGQAVEMFCDIGRISMAARYYKEIAELYESEANVEKAMDFYEKAADFFQGEEVTTSANQCKQKVAQFAAQLEQYQKAIEIYEEIARHSLSNNLLKYGVKGHLLNAGICHLCKGDVVSVTNALERYQDLDPTFSGTREYRLLADVAAAIDEEDVAKFTDVVKEFDSMTPLDSWKTTLLLRVKEKLKAKELEEDDLT",
"proteome": "UP000008311",
"gene": "RCOM_0688690",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006886",
"name": "intracellular protein transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5b0c27421c7a6a08819c4985a5bcbf1712deca25",
"counters": {
"domain_architectures": 11254,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"cdd": 1,
"smart": 1,
"profile": 1,
"panther": 1,
"prints": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 11254
}
}
}