HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B9M5U4",
"id": "RL25_GEODF",
"source_organism": {
"taxId": "316067",
"scientificName": "Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)",
"fullName": "Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)"
},
"name": "Large ribosomal subunit protein bL25",
"description": [
"This is one of the proteins that binds to the 5S RNA in the ribosome where it forms part of the central protuberance"
],
"length": 196,
"sequence": "MDQRILNVELRSKTGKGISRQLRRSESIPGVVYGKGIESVSVSLKTKELSNAIAGEGGRNHILTLKGGGSLDGQMVIVADLLQDSLKGLPLHVDLHKINLADKIKVKVKVNLVGTAAGVKEGGLLDFAMHEIEIECLPSHIPEHLDVDVTSLTLGHSIHIGDLKELPGIKVLGDPKASIISVLGRAKEEAAPVAEA",
"proteome": "UP000007721",
"gene": "rplY",
"go_terms": [
{
"identifier": "GO:0003735",
"name": "structural constituent of ribosome",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006412",
"name": "translation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005840",
"name": "ribosome",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0008097",
"name": "5S rRNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "18556c84677b41f4736214af61f86e05d0794439",
"counters": {
"domain_architectures": 21163,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"cathgene3d": 2,
"ssf": 1,
"pfam": 2,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 21163
}
}
}