GET /api/protein/UniProt/B9H920/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B9H920",
        "id": "B9H920_POPTR",
        "source_organism": {
            "taxId": "3694",
            "scientificName": "Populus trichocarpa",
            "fullName": "Populus trichocarpa (Western balsam poplar)"
        },
        "name": "Aspartate aminotransferase",
        "description": [
            "Important for the metabolism of amino acids and Krebs-cycle related organic acids. In plants, it is involved in nitrogen metabolism and in aspects of carbon and energy metabolism"
        ],
        "length": 449,
        "sequence": "MNPELTSPSSSSDRRISVLARHLVGVEMDPQNDSISAFPTSGSDSNSVFSHVVRGPEDPILGVTVAYNKDPSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQLLVNDRSRVKEYLPITGLAEFNKLSAKLMFGANCPAIQENRVTTVQCLSGTGSLRVGAEFLAKHHHQRTIYIPQPTWGNHPKIFTLAGLSVKTYRYYDPATRGLNFQGLVEDLNSAPSGAIVLLHACAHNPTGVDPTSQQWEQIRKLMRSKGLMPFFDSAYQGFASGSLDADAQPVRMFVADGGELLLAQSYAKNMGLYGERIGALSIVCKTADVAGRVESQLKLVIRPMYSNPPIHGASIVAAILKDRDLYNEWTIELKAMADRIISMRQKLFEALHARGTPGDWSHIVKQIGMFTFTGLNSKQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAMHAAVKRVV",
        "proteome": "UP000006729",
        "gene": "POPTR_006G241600",
        "go_terms": [
            {
                "identifier": "GO:0030170",
                "name": "pyridoxal phosphate binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009058",
                "name": "biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008483",
                "name": "transaminase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006520",
                "name": "amino acid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "220d43766bfe69807874ea078bc783ea7854e968",
        "counters": {
            "domain_architectures": 344728,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 344728
        }
    }
}