HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B9E5X0",
"id": "B9E5X0_CLOK1",
"source_organism": {
"taxId": "583346",
"scientificName": "Clostridium kluyveri (strain NBRC 12016)",
"fullName": "Clostridium kluyveri (strain NBRC 12016)"
},
"name": "2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase",
"description": [
"Catalyzes the transfer of an acetyl group from acetyl-CoA to tetrahydrodipicolinate"
],
"length": 238,
"sequence": "METKYDLTDPYQIAKYIKEAKKSTPLKVYLQGSISSCNLKNIECYGSNNFYVLFGESADICKFLDENKNKIEQFRIEQDRRNSAIPLIDLINIDARIEPGAIIRDKVKIGKNAVIMMGAVINIGAEIGEGTMIDMNAVVGARGKLGKNVHLGAGAVVAGVLEPPSKSPCEIGDDVLIGANSVILEGVKVGKGSVIAAGSIVIEDVPEGVVAGGTPARILKSVDDMTKDKTKILADLRK",
"proteome": null,
"gene": "dapH",
"go_terms": [
{
"identifier": "GO:0047200",
"name": "tetrahydrodipicolinate N-acetyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009089",
"name": "L-lysine biosynthetic process via diaminopimelate",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016740",
"name": "transferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8e01d45235b0ce953e2a66787d7dbabea0253cda",
"counters": {
"domain_architectures": 92,
"entries": 16,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"cdd": 1,
"pfam": 2,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 92
}
}
}