HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B8ZQ37",
"id": "RNH2_STRPJ",
"source_organism": {
"taxId": "561276",
"scientificName": "Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)",
"fullName": "Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)"
},
"name": "Ribonuclease HII",
"description": [
"Endonuclease that specifically degrades the RNA of RNA-DNA hybrids"
],
"length": 259,
"sequence": "MATIKEIKEFLVTVKELESPIFLELEKDNRSGVQKEISKRKRAIQAELDENLRLESMLSYEKELYKQGLTLIVGIDEVGRGPLAGPVVAAAVILPKNCKIKGLNDSKKIPKKKHLEIFQAVQDQALSIGIGIIDNQVIDQVNIYEATKLAMQEAISQLSPQPEHLLIDAMKLDLPISQTSIIKGDANSLSIAAASIVAKVTRDELMKEYDQQFPGYDFATNAGYGTAKHLEGLTKLGVTPIHRTSFEPVKSLVLGKKES",
"proteome": null,
"gene": "rnhB",
"go_terms": [
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004523",
"name": "RNA-DNA hybrid ribonuclease activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5af056306f43ade9b3d5c3dcd64e563b9e2419f6",
"counters": {
"domain_architectures": 3783,
"entries": 15,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"cdd": 1,
"ncbifam": 2,
"panther": 1,
"hamap": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 3783
}
}
}