General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B8ZHC9",
        "id": "S2541_RAT",
        "source_organism": {
            "taxId": "10116",
            "scientificName": "Rattus norvegicus",
            "fullName": "Rattus norvegicus (Rat)"
        },
        "name": "Calcium-independent mitochondrial carrier protein SCaMC-3L",
        "description": [
            "Calcium-independent ATP-Mg/Pi exchanger that catalyzes the electroneutral exchange of Mg-ATP or free ADP against an hydrogenphosphate and participates in the net transport of adenine nucleotides across the mitochondria inner membrane"
        ],
        "length": 312,
        "sequence": "MGVHLEVLDTGEQLMVPGDVLEEENKGTLWKFLLSGAMAGAVSRTGTAPLDRARVYMQVYSSKSNFRHLLSGLRSLVQEGGIRSLWRGNGINVLKIAPEYAIKFSVFEQSRNFFYGVHTSPSFQERVVAGSLAVAISQTLINPMEVLKTRLTLRFTGQYKGLLDCARQILERDGTRALYRGYLPNMLGIIPYACTDLAVYELLRCLWQKSGRDMKDPSGLVSLSSVTLSTTCGQMASYPLTLVRTRMQAQDTVEGSNPTMLGVFKRILNQQGWPGLYRGMTPTLLKVLPAGGISYLVYEAMKKTLGVQVLSR",
        "proteome": "UP000002494",
        "gene": "Slc25a41",
        "go_terms": [
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e037822792ef5f5d7967370632f8bf737b916266",
        "counters": {
            "domain_architectures": 140476,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 140476
        }
    }
}