GET /api/protein/UniProt/B8J3R4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B8J3R4",
"id": "B8J3R4_DESDA",
"source_organism": {
"taxId": "525146",
"scientificName": "Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)",
"fullName": "Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)"
},
"name": "Lipoprotein signal peptidase",
"description": [
"This protein specifically catalyzes the removal of signal peptides from prolipoproteins"
],
"length": 178,
"sequence": "MRRRYRILGGMALLALVLDQLTKYVVMQTIPEHRSVPVIEGLFDLVNIRNRGAAFGFLNRSDIEWQFWLFLGATVVAVWAILMLVRSSHDEPWLFAGLGLVMGGALGNLVDRIRFRAVVDFLDVYWGDWHWPAFNVADSAIFVGAALACVIMWRKPPENGNEKGSKAGKSSGKRGRAA",
"proteome": null,
"gene": "lspA",
"go_terms": [
{
"identifier": "GO:0004190",
"name": "aspartic-type endopeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006508",
"name": "proteolysis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a5317830b79a52cfb9ee4b1304642289c6caf194",
"counters": {
"domain_architectures": 29002,
"entries": 7,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ncbifam": 1,
"hamap": 1,
"panther": 1,
"pfam": 1,
"prints": 1,
"prosite": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 29002
}
}
}