GET /api/protein/UniProt/B8J2P7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B8J2P7",
        "id": "B8J2P7_DESDA",
        "source_organism": {
            "taxId": "525146",
            "scientificName": "Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)",
            "fullName": "Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)"
        },
        "name": "ADP-L-glycero-D-manno-heptose-6-epimerase",
        "description": [
            "Catalyzes the interconversion between ADP-D-glycero-beta-D-manno-heptose and ADP-L-glycero-beta-D-manno-heptose via an epimerization at carbon 6 of the heptose"
        ],
        "length": 323,
        "sequence": "MYVITGGAGFLGSALLWQLNCMNIDDIVIVDNLARSDKWRNLVKRRYVDYLHRDQFYDLMQRDALPWKVSGVVHLGACSSTTEKDADFLMENNFHYSRDLCRYTLDKGGRFINASSAATYGDGSLGFSDDEQLVPRLRPLNMYGYSKQLFDLWLLREGLQAETASLKFFNVYGPNEYHKGDMQSVAAKAHRQIGQEGLLRLFRSDRPDVADGEQKRDFVYVKDCTALMAWLLERNDVCGIHNVGTGTARSFNDLAQAVFAALNRPCHIEYVDMPDSLRGRYQHYTQADMAWLGQVDCPLAFTPLEEGVADYVKGYLEKEDPYL",
        "proteome": null,
        "gene": "hldD",
        "go_terms": [
            {
                "identifier": "GO:0008712",
                "name": "ADP-glyceromanno-heptose 6-epimerase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0050661",
                "name": "NADP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005975",
                "name": "carbohydrate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "98c4462178d35ec13da36dff1f5dc1953e343697",
        "counters": {
            "domain_architectures": 265569,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "cathgene3d": 2,
                "ssf": 1,
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "ncbifam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 265569
        }
    }
}