GET /api/protein/UniProt/B8HN65/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B8HN65",
"id": "NTPP_CYAP4",
"source_organism": {
"taxId": "395961",
"scientificName": "Cyanothece sp. (strain PCC 7425 / ATCC 29141)",
"fullName": "Cyanothece sp. (strain PCC 7425 / ATCC 29141)"
},
"name": "Nucleoside triphosphate pyrophosphatase",
"description": [
"Nucleoside triphosphate pyrophosphatase. May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides into cellular nucleic acids"
],
"length": 195,
"sequence": "MLQFVLASASPARRQLLQSIGINPLVYQSNFDESSVAIADHHELVQTLARCKAEVVANQLAAPALVLGCDSVLVLQGKIYGKPKDPADAIARWQSMRGQSGELLTGHTLIDLYQNKTLVRLEITQVDFAWISDRQIAAYVATGEPLNCAGAFALDGRGGLFVDRIVGCPSNVIGLSLPLLRKMLTALGYSPADCW",
"proteome": null,
"gene": "Cyan7425_4892",
"go_terms": [
{
"identifier": "GO:0047429",
"name": "nucleoside triphosphate diphosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4e50f860811e8bd429a94ec3d863c201dce946d0",
"counters": {
"domain_architectures": 36724,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"ncbifam": 1,
"pirsf": 1,
"panther": 1,
"hamap": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 36724
}
}
}