GET /api/protein/UniProt/B8D8H9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B8D8H9",
"id": "YIDC_BUCA5",
"source_organism": {
"taxId": "563178",
"scientificName": "Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)",
"fullName": "Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)"
},
"name": "Membrane protein insertase YidC",
"description": [
"Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Aids folding of multispanning membrane proteins"
],
"length": 532,
"sequence": "MEVQRNFFIFAFLFVSFLLWQAWQSQMFLNKKTNEKIDPIFHFIDVKKNKKKIFIKNDVISLVVNMYGGDVEEASLLAYKDTLYSSRPFKLLETGSDFIYQAQSGLIGKDGPDSSINDSRPLYSANKNFFVLGPNEKELRVPIKWVSKNGVIYKKTFILKPNRYDVQIEYDVYNPSKESLNMNIFGQIKQTINLPKKRNVYSGNFALQTFRGAAYSSDDNKYEKYKFDMIANNKNLHIMTESGWIAMLQQYFAVAWIPDNLGKNTIYTSSLDHDTAVIGYKSPIINIPPNSRSIIKSKLWIGPEIQKEMKLVAPNLDLTVDYGWLWFLSQPLFKLLTILYSIIGNWGFSIILITFIMRGLTYPLTKAQYISMAKMRALQPKIQEIKEKFSKDKQRISQEMILLYKKEKINPLGGFLPIFIQMPIFLSLYYMLIGSVELRHAPFLLWIHDLSSQDPYYVLPVIMGLTMFFIQKISSTNHISDPLQKKIMNFMPVIFTAFFLWFPSGLVLYYIISNLVTIIQQKFILSNLEKNR",
"proteome": null,
"gene": "yidC",
"go_terms": [
{
"identifier": "GO:0032977",
"name": "membrane insertase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ec18427aa1e4c88bda005bb20330293a82437811",
"counters": {
"domain_architectures": 13619,
"entries": 19,
"isoforms": 0,
"proteomes": 0,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 2,
"cdd": 2,
"ncbifam": 4,
"hamap": 1,
"panther": 1,
"prints": 2,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 13619
}
}
}