General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B8C0K4",
        "id": "B8C0K4_THAPS",
        "source_organism": {
            "taxId": "35128",
            "scientificName": "Thalassiosira pseudonana",
            "fullName": "Thalassiosira pseudonana (Marine diatom)"
        },
        "name": "Fucoxanthin chlorophyll a/c light-harvesting protein, lhcr type",
        "description": [
            "The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated. Energy is transferred from the carotenoid and chlorophyll C (or B) to chlorophyll A and the photosynthetic reaction centers where it is used to synthesize ATP and reducing power"
        ],
        "length": 203,
        "sequence": "MMKSVIIASLACSAAAFAPASNGRAATSLEASAKSKALPWLPNPSNLDGRIGANGFDPLGISEYFPVDYLVESEIKHGRVCMMAWAGYVAVDLGARIYPLPESMQGVTSATAHDPAVAFGSMGNMFIWIALFEMVGWIGLSQTLQGSGREPGDFGWGKQFMGKTQAEIDTMKLKELTNGRAAMLAFAGVVTQSVLYDKGFPYF",
        "proteome": "UP000001449",
        "gene": "Lhcr14",
        "go_terms": [
            {
                "identifier": "GO:0009765",
                "name": "photosynthesis, light harvesting",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c3c39b492cec2880b905b58a2a6af891ce705de4",
        "counters": {
            "domain_architectures": 20743,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 2,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 20743
        }
    }
}