GET /api/protein/UniProt/B8ALR6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B8ALR6",
        "id": "B8ALR6_ORYSI",
        "source_organism": {
            "taxId": "39946",
            "scientificName": "Oryza sativa subsp. indica",
            "fullName": "Oryza sativa subsp. indica (Rice)"
        },
        "name": "Uncharacterized protein",
        "description": [
            "Involved in the targeting and/or fusion of transport vesicles to their target membrane"
        ],
        "length": 220,
        "sequence": "MGQQSLIYAFVARGTVILAEYTEFTGNFTTIASQCLMKLPASNNKFTYNCDGHTFNYLVEDGFTYCVVAVESVGRQIPIAFLDRVKDDFTKRYAGGKAATAAANSLNRDFGSKLKEHMQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQAGTQVRRKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKCK",
        "proteome": "UP000007015",
        "gene": "OsI_13946",
        "go_terms": [
            {
                "identifier": "GO:0016192",
                "name": "vesicle-mediated transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e09a1477707fd7f9badcb09d6cf1d43f3f6a69d9",
        "counters": {
            "domain_architectures": 17217,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "cdd": 2,
                "profile": 2,
                "smart": 1,
                "pfam": 2,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 17217
        }
    }
}