General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B7ZCL9",
        "id": "B7ZCL9_MOUSE",
        "source_organism": {
            "taxId": "10090",
            "scientificName": "Mus musculus",
            "fullName": "Mus musculus (Mouse)"
        },
        "name": "Membrane protein, palmitoylated",
        "description": [
            "Essential regulator of neutrophil polarity. Regulates neutrophil polarization by regulating AKT1 phosphorylation through a mechanism that is independent of PIK3CG activity"
        ],
        "length": 205,
        "sequence": "MTLKSSEGEGGNSMRTALSDLYLEHLLQKRNRPEMFMRAQFDYDPQKDNLIPCKEAGLKFVTGDIIQIINKDDSNWWQGRVEGSSKESAGLIPSPELQEWRVASVAHSAPSEAPSCSPFGKKKKCKDKYLAKHSSIFDQLDVVSYEEVVRLPAFKRKTLVLIGASGVGRSHIKNGLLSHNPEKFAYPAPYTTRPPKKSEEDGKEY",
        "proteome": "UP000000589",
        "gene": "Mpp1",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "adc234a1f87e6da507e0a449753e51db5369adbd",
        "counters": {
            "domain_architectures": 303,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "profile": 2,
                "smart": 1,
                "pfam": 2,
                "cdd": 1,
                "panther": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 303
        }
    }
}