HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B7UWI0",
"id": "HSCB_PSEA8",
"source_organism": {
"taxId": "557722",
"scientificName": "Pseudomonas aeruginosa (strain LESB58)",
"fullName": "Pseudomonas aeruginosa (strain LESB58)"
},
"name": "Co-chaperone protein HscB homolog",
"description": [
"Co-chaperone involved in the maturation of iron-sulfur cluster-containing proteins. Seems to help targeting proteins to be folded toward HscA"
],
"length": 173,
"sequence": "MGKPCHFAQFDLQPAFLVDLDELGQRYRELVRSVHPDRFADAPEREQRLALERAAQLNEAYQTLKSAPRRALYLLTLSGHELPLEATVQDPEFLLQQMQLREELEELQDSADLAGVATFKRRLKAAQAELEREFAACWDDAQRREEAERLVRRMQFLDKLAQEVRQLEERLDD",
"proteome": null,
"gene": "hscB",
"go_terms": [
{
"identifier": "GO:0051259",
"name": "protein complex oligomerization",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0001671",
"name": "ATPase activator activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051087",
"name": "protein-folding chaperone binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0044571",
"name": "[2Fe-2S] cluster assembly",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "9fe0468b93fae12488b77b2ca70f6e0f3899b5e9",
"counters": {
"domain_architectures": 3224,
"entries": 18,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"profile": 1,
"ssf": 2,
"cathgene3d": 2,
"cdd": 1,
"pfam": 2,
"ncbifam": 2,
"hamap": 1,
"panther": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 3224
}
}
}