GET /api/protein/UniProt/B7UK53/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B7UK53",
"id": "TUSB_ECO27",
"source_organism": {
"taxId": "574521",
"scientificName": "Escherichia coli O127:H6 (strain E2348/69 / EPEC)",
"fullName": "Escherichia coli O127:H6 (strain E2348/69 / EPEC)"
},
"name": "Protein TusB",
"description": [
"Part of a sulfur-relay system required for 2-thiolation of 5-methylaminomethyl-2-thiouridine (mnm(5)s(2)U) at tRNA wobble positions"
],
"length": 95,
"sequence": "MLHTLHRSPWLTDFAALLRLLSEGDELLLLQDGVTAAVDGNRYLESLRNAPIKVYALNEDLIARGLTGQISNDIIPIDYTDFVRLTVKHSSQMAW",
"proteome": "UP000008205",
"gene": "tusB",
"go_terms": [
{
"identifier": "GO:0002143",
"name": "tRNA wobble position uridine thiolation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "24690c31e06ef878f71c5b136686b0ff1eb30318",
"counters": {
"domain_architectures": 4225,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"ncbifam": 2,
"hamap": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4225
}
}
}