GET /api/protein/UniProt/B7UIN3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B7UIN3",
"id": "B7UIN3_ECO27",
"source_organism": {
"taxId": "574521",
"scientificName": "Escherichia coli O127:H6 (strain E2348/69 / EPEC)",
"fullName": "Escherichia coli O127:H6 (strain E2348/69 / EPEC)"
},
"name": "Lipopolysaccharide export system permease protein LptF",
"description": [
"Part of the ABC transporter complex LptBFG involved in the translocation of lipopolysaccharide (LPS) from the inner membrane to the outer membrane"
],
"length": 356,
"sequence": "MKLVEHYIMRGTRRLVLIIVGFLIFIFASYSAQRYLTEAANGTLALDVVLDIVFYKVLIALEMLLPVGLYVSVGVTLGQMYTDSEITAISAAGGSPGRLYKAVLYLAIPLSIFVTLLSMYGRPWAYAQIYQLEQQSQSELDVRQLRAKQFNTNDNGRMILSQTVDQDNNRLTDALIYTSTANRTRIFRARSVDVVDPSPEKPTVMLHNGTAYLLDHQGRDDNEQIYRNLQLHLNPLDQSPNVKRKAKSVTELARSAFPADHAELQWRQSRGLTALLMALLAISLSRVKPRQGRFSTLLPLTLLFVAIFYGGDVCRTLVANGAIPLIPGLWLVPGLMLMGLLMLVARDFSLLQKFSR",
"proteome": "UP000008205",
"gene": "E2348C_3267",
"go_terms": [
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0055085",
"name": "transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0043190",
"name": "ATP-binding cassette (ABC) transporter complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ebf4005e3439dbb950106726b20720618a594c95",
"counters": {
"domain_architectures": 29927,
"entries": 5,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 29927
}
}
}