GET /api/protein/UniProt/B7UIE7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B7UIE7",
        "id": "SECM_ECO27",
        "source_organism": {
            "taxId": "574521",
            "scientificName": "Escherichia coli O127:H6 (strain E2348/69 / EPEC)",
            "fullName": "Escherichia coli O127:H6 (strain E2348/69 / EPEC)"
        },
        "name": "Secretion monitor",
        "description": [
            "Regulates secA expression by translational coupling of the secM secA operon. Translational pausing at a specific Pro residue 5 residues before the end of the protein may allow disruption of a mRNA repressor helix that normally suppresses secA translation initiation"
        ],
        "length": 170,
        "sequence": "MSGILTRWRQFGKRYFWPHLLLGMVAASLGLPALSNAAEPNAPAKATTRNHEPSAKVNFGQLALLEANTRRPNSNYSVDYWHQHAIRTVIRHLSFAMAPQTLPVAEESLPLQAQHLALLDTLSALLTQEGTPSEKGYRIDYAHFTPQAKFSTPVWISHAQGIRAGPQRLS",
        "proteome": "UP000008205",
        "gene": "secM",
        "go_terms": [
            {
                "identifier": "GO:0045182",
                "name": "translation regulator activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7522f82e3a8c6faaa65831a0d542c312b8348e44",
        "counters": {
            "domain_architectures": 1393,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pirsf": 1,
                "hamap": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1393
        }
    }
}