GET /api/protein/UniProt/B7UHJ3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B7UHJ3",
"id": "B7UHJ3_ECO27",
"source_organism": {
"taxId": "574521",
"scientificName": "Escherichia coli O127:H6 (strain E2348/69 / EPEC)",
"fullName": "Escherichia coli O127:H6 (strain E2348/69 / EPEC)"
},
"name": "7-carboxy-7-deazaguanine synthase",
"description": [
"Catalyzes the complex heterocyclic radical-mediated conversion of 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) to 7-carboxy-7-deazaguanine (CDG), a step common to the biosynthetic pathways of all 7-deazapurine-containing compounds"
],
"length": 223,
"sequence": "MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPVGCAWCDTKHTWEKLEDREVSLFSILAKTKESDKWGAASSEDLLAVIGRQGYTARHVVITGGEPCIHDLLPLTDLLEKNGFSCQIETSGTHEVRCTPNTWVTVSPKLNMRGGYEVLSQALERANEIKHPVGRVRDIEALDELLATLTDDKPRVIALQPISQKEDATRLCIDTCIARNWRLSMQTHKYLNIA",
"proteome": "UP000008205",
"gene": "ygcF",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051536",
"name": "iron-sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": null,
"counters": {
"domain_architectures": 0,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"ssf": 1,
"panther": 1,
"pirsf": 1,
"hamap": 1,
"ncbifam": 1,
"sfld": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1
}
}
}