GET /api/protein/UniProt/B7UHJ3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B7UHJ3",
        "id": "B7UHJ3_ECO27",
        "source_organism": {
            "taxId": "574521",
            "scientificName": "Escherichia coli O127:H6 (strain E2348/69 / EPEC)",
            "fullName": "Escherichia coli O127:H6 (strain E2348/69 / EPEC)"
        },
        "name": "7-carboxy-7-deazaguanine synthase",
        "description": [
            "Catalyzes the complex heterocyclic radical-mediated conversion of 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) to 7-carboxy-7-deazaguanine (CDG), a step common to the biosynthetic pathways of all 7-deazapurine-containing compounds"
        ],
        "length": 223,
        "sequence": "MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPVGCAWCDTKHTWEKLEDREVSLFSILAKTKESDKWGAASSEDLLAVIGRQGYTARHVVITGGEPCIHDLLPLTDLLEKNGFSCQIETSGTHEVRCTPNTWVTVSPKLNMRGGYEVLSQALERANEIKHPVGRVRDIEALDELLATLTDDKPRVIALQPISQKEDATRLCIDTCIARNWRLSMQTHKYLNIA",
        "proteome": "UP000008205",
        "gene": "ygcF",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051536",
                "name": "iron-sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "ssf": 1,
                "panther": 1,
                "pirsf": 1,
                "hamap": 1,
                "ncbifam": 1,
                "sfld": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1
        }
    }
}