General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B7QKS1",
        "id": "CIAO1_IXOSC",
        "source_organism": {
            "taxId": "6945",
            "scientificName": "Ixodes scapularis",
            "fullName": "Ixodes scapularis (Black-legged tick)"
        },
        "name": "Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog",
        "description": [
            "Essential component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for the maturation of extramitochondrial Fe/S proteins"
        ],
        "length": 315,
        "sequence": "MKMSKLSDLEGHEDRVWNVAWNPSGTILASCGGDKSIRLWGLEGGSWVCKSVLLDGHQRTVRGVSWSNCGRYLASSSFDGTTCIWRRQDDTFESCATLEGHENEVKACGWSPSGRFLATCSRDKTVWIWEVGEDEEFECASVQTCHSQDVKKVLWHPDRDELASASYDNTIRFFCEEVDDWQCYCTLDKHASTVWGLSFGPGPEPQLASCAADGSVYVWGTKGDRRSWELCGTLERHPRPVYDVSWCRTRGFLATACGDNAVRVFVKDGGDCSWRLGCTLTQAHSQDVNSVSWSPSGGLLASAGDDGYVRLWQID",
        "proteome": "UP000001555",
        "gene": "ISCW023049",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016226",
                "name": "iron-sulfur cluster assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0097361",
                "name": "cytosolic [4Fe-4S] assembly targeting complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "87f0491a909b57bb621cadc1b0f405a1de582499",
        "counters": {
            "domain_architectures": 21012,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 3,
                "smart": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "cdd": 1,
                "hamap": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 21012
        }
    }
}