GET /api/protein/UniProt/B7P3J7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B7P3J7",
        "id": "B7P3J7_IXOSC",
        "source_organism": {
            "taxId": "6945",
            "scientificName": "Ixodes scapularis",
            "fullName": "Ixodes scapularis (Black-legged tick)"
        },
        "name": "Synaptobrevin 1-2, putative",
        "description": [
            "SNARE involved in targeting and fusion of ER-derived transport vesicles with the Golgi complex as well as Golgi-derived retrograde transport vesicles with the ER"
        ],
        "length": 214,
        "sequence": "MVLMTMIARVADGLPLSASVQDDQQQLGPGNTEYQNQAKMLFKKLNDQSFSKSTIETGPYNFHYLIENGVCYLVLTEKSFSKRLAFSFLEDLQNEFNSQYGSRVNSVNRPYSFIEFDTYIQKAKKSFMDSRARRNLTNLNSELQDVQRIMVQNIDDVLQRGSVISELDSKASNLSLLSQKYKKDARYLNLRSTYAKLAAVAVVVFVGFLYFYIF",
        "proteome": "UP000001555",
        "gene": "8024088",
        "go_terms": [
            {
                "identifier": "GO:0005484",
                "name": "SNAP receptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006888",
                "name": "endoplasmic reticulum to Golgi vesicle-mediated transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006890",
                "name": "retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e09a1477707fd7f9badcb09d6cf1d43f3f6a69d9",
        "counters": {
            "domain_architectures": 17217,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 2,
                "cdd": 2,
                "profile": 2,
                "smart": 1,
                "pfam": 2,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 17217
        }
    }
}