General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B7NEF3",
        "id": "B7NEF3_ECOLU",
        "source_organism": {
            "taxId": "585056",
            "scientificName": "Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)",
            "fullName": "Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)"
        },
        "name": "Acid stress chaperone HdeA",
        "description": [
            "Required for optimal acid stress protection. Exhibits a chaperone-like activity only at low pH by suppressing non-specifically the aggregation of denaturated periplasmic proteins"
        ],
        "length": 110,
        "sequence": "MKKVLGVILGGLLLLPVVSNAADAQKAADNKKPVNSWTCEDFLAVDESFQPTAVGFAEALNNKDKPEDAVLDVQGIATVTPAIVQACTQDKQANFKDKVKGEWDKIKKDM",
        "proteome": null,
        "gene": "hdeA",
        "go_terms": [
            {
                "identifier": "GO:0071468",
                "name": "cellular response to acidic pH",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0030288",
                "name": "outer membrane-bounded periplasmic space",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fd4fc2aa63f7a42ff9159e954ff9981f5f21fdb7",
        "counters": {
            "domain_architectures": 1575,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "ncbifam": 1,
                "hamap": 1,
                "pirsf": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1575
        }
    }
}