GET /api/protein/UniProt/B7N7W6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B7N7W6",
"id": "B7N7W6_ECOLU",
"source_organism": {
"taxId": "585056",
"scientificName": "Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)",
"fullName": "Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)"
},
"name": "Cell division protein FtsQ",
"description": [
"Essential cell division protein. May link together the upstream cell division proteins, which are predominantly cytoplasmic, with the downstream cell division proteins, which are predominantly periplasmic. May control correct divisome assembly"
],
"length": 276,
"sequence": "MSQAALNTRNSEEEVSSRRNNGTRLAGILFLLTVLTTVLVSGWVVLGWMEDAQRLPLSKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLPWIKQVSVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPDRTSKQVLPMLYGPEGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLARFVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESTQQQNQAQAEQQ",
"proteome": null,
"gene": "ftsQ",
"go_terms": [
{
"identifier": "GO:0090529",
"name": "cell septum assembly",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5f5929f89509e2ac48b5be0305a41c53d4000200",
"counters": {
"domain_architectures": 15959,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"pfam": 2,
"cathgene3d": 2,
"panther": 1,
"ncbifam": 1,
"hamap": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 15959
}
}
}