GET /api/protein/UniProt/B7MNI8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B7MNI8",
        "id": "DEOC_ECO45",
        "source_organism": {
            "taxId": "585035",
            "scientificName": "Escherichia coli O45:K1 (strain S88 / ExPEC)",
            "fullName": "Escherichia coli O45:K1 (strain S88 / ExPEC)"
        },
        "name": "Deoxyribose-phosphate aldolase",
        "description": [
            "Catalyzes a reversible aldol reaction between acetaldehyde and D-glyceraldehyde 3-phosphate to generate 2-deoxy-D-ribose 5-phosphate"
        ],
        "length": 259,
        "sequence": "MTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGHGDGKSASSY",
        "proteome": "UP000000747",
        "gene": "deoC",
        "go_terms": [
            {
                "identifier": "GO:0016829",
                "name": "lyase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004139",
                "name": "deoxyribose-phosphate aldolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009264",
                "name": "deoxyribonucleotide catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "eef5f42e892995aae7b9ad95dbe411ff3160f897",
        "counters": {
            "domain_architectures": 38504,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "cdd": 1,
                "pfam": 1,
                "hamap": 1,
                "panther": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 38504
        }
    }
}