HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B7MNI8",
"id": "DEOC_ECO45",
"source_organism": {
"taxId": "585035",
"scientificName": "Escherichia coli O45:K1 (strain S88 / ExPEC)",
"fullName": "Escherichia coli O45:K1 (strain S88 / ExPEC)"
},
"name": "Deoxyribose-phosphate aldolase",
"description": [
"Catalyzes a reversible aldol reaction between acetaldehyde and D-glyceraldehyde 3-phosphate to generate 2-deoxy-D-ribose 5-phosphate"
],
"length": 259,
"sequence": "MTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGHGDGKSASSY",
"proteome": "UP000000747",
"gene": "deoC",
"go_terms": [
{
"identifier": "GO:0016829",
"name": "lyase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004139",
"name": "deoxyribose-phosphate aldolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009264",
"name": "deoxyribonucleotide catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "eef5f42e892995aae7b9ad95dbe411ff3160f897",
"counters": {
"domain_architectures": 38504,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"cdd": 1,
"pfam": 1,
"hamap": 1,
"panther": 1,
"pirsf": 1,
"ncbifam": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 38504
}
}
}