General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B7M7B0",
        "id": "RIMO_ECO8A",
        "source_organism": {
            "taxId": "585034",
            "scientificName": "Escherichia coli O8 (strain IAI1)",
            "fullName": "Escherichia coli O8 (strain IAI1)"
        },
        "name": "Ribosomal protein uS12 methylthiotransferase RimO",
        "description": [
            "Catalyzes the methylthiolation of an aspartic acid residue of ribosomal protein uS12"
        ],
        "length": 441,
        "sequence": "MSKVTPQPKIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKVIVTGCLGAKEDQIREVHPKVLEITGPHSYEQVLEHVHHYVPKPKHNPFLSLVPEQGVKLTPRHYAYLKISEGCNHRCTFCIIPSMRGDLVSRPIGEVLSEAKRLVDAGVKEILVISQDTSAYGVDVKHRTGFHNGEPVKTSMVSLCEQLSKLGIWTRLHYVYPYPHVDDVIPLMAEGKILPYLDIPLQHASPRILKLMKRPGSVDRQLARIKQWREICPELTLRSTFIVGFPGETEEDFQMLLDFLKEARLDRVGCFKYSPVEGADANALPDQVPEEVKEERWNRFMQLQQQISAERLQEKVGREILVIIDEVDEEGAIGRSMADAPEIDGAVYLNGETNVKPGDILRVKVEHADEYDLWGSRV",
        "proteome": null,
        "gene": "rimO",
        "go_terms": [
            {
                "identifier": "GO:0035596",
                "name": "methylthiotransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051539",
                "name": "4 iron, 4 sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051536",
                "name": "iron-sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016740",
                "name": "transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006400",
                "name": "tRNA modification",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0018339",
                "name": "peptidyl-L-beta-methylthioaspartic acid biosynthetic process from peptidyl-aspartic acid",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "720538ec35dc3fd38412b2d06407e7c5f9ea5637",
        "counters": {
            "domain_architectures": 15934,
            "entries": 32,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 3,
                "cathgene3d": 3,
                "ssf": 1,
                "smart": 1,
                "cdd": 1,
                "pfam": 3,
                "sfld": 4,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 2,
                "prosite": 1,
                "interpro": 11
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 15934
        }
    }
}