General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B7LVE3",
        "id": "RHAM_ESCF3",
        "source_organism": {
            "taxId": "585054",
            "scientificName": "Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)",
            "fullName": "Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)"
        },
        "name": "L-rhamnose mutarotase",
        "description": [
            "Involved in the anomeric conversion of L-rhamnose"
        ],
        "length": 104,
        "sequence": "MIRKAFVMQVNPDAHEEYQHRHNPIWPELEVVLKSHGAHNYAIYLDKARNLLFATVEIESEERWNAVASTDVCQRWWKYMTDVMPANPNNSPVSSELQEVFYLP",
        "proteome": "UP000000745",
        "gene": "rhaM",
        "go_terms": [
            {
                "identifier": "GO:0016857",
                "name": "racemase and epimerase activity, acting on carbohydrates and derivatives",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e61983342a9bc19073132c4a4ead980606ee4017",
        "counters": {
            "domain_architectures": 11711,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 11711
        }
    }
}