GET /api/protein/UniProt/B7JFZ3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B7JFZ3",
"id": "HIS5_BACC0",
"source_organism": {
"taxId": "405535",
"scientificName": "Bacillus cereus (strain AH820)",
"fullName": "Bacillus cereus (strain AH820)"
},
"name": "Imidazole glycerol phosphate synthase subunit HisH",
"description": [
"IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF"
],
"length": 209,
"sequence": "MIAIIDYGMGNIRSVEQALKYIGAAYIVTSDKEEIFRSDGVILPGVGAFPKAMDILEEKDLVRVLQEIGRSRKPLLGICLGMQLLFEKSEELQDCNGLSLLPGVIRKLKVPYKIPHMGWNELKKEGEIALWNGVEDGSFVYYVHSYYADCPNEIVYGVSDYGVEVPGFVAKGNIYGAQFHPEKSGDIGMQMLKNFKGVVETWKSSQLSI",
"proteome": null,
"gene": "hisH",
"go_terms": [
{
"identifier": "GO:0016763",
"name": "pentosyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000105",
"name": "L-histidine biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a79a81cdbd2eef5f5e295147e6f92925489d815d",
"counters": {
"domain_architectures": 82564,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"pfam": 1,
"hamap": 1,
"pirsf": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 82564
}
}
}