General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B7J4B5",
        "id": "B7J4B5_ACIF2",
        "source_organism": {
            "taxId": "243159",
            "scientificName": "Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)",
            "fullName": "Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)"
        },
        "name": "Probable S-methyl-5'-thioinosine phosphorylase",
        "description": [
            "Catalyzes the reversible phosphorylation of S-methyl-5'-thioinosine (MTI) to hypoxanthine and 5-methylthioribose-1-phosphate. Involved in the breakdown of S-methyl-5'-thioadenosine (MTA), a major by-product of polyamine biosynthesis. Catabolism of (MTA) occurs via deamination to MTI and phosphorolysis to hypoxanthine"
        ],
        "length": 270,
        "sequence": "MGVAGIIGGSGLTGLKNLQIRHRRVIRTPFGETSGPLTFGQLGGQEVVFIARHGYGHTIPPHRVNYRANVWALHHVGVTHVVAVAAVGGITAAMRPGVLCLPDQLIDYTSGRPSTFFEGGESMVVHIDFSEPYCQPLRERLLQAAGSADIVVIDGGTYAATQGPRLETIAEIRRIERDGGDVVGMTGAPEAVLAREIGLCYAPLSLVVNPAAGKSAEPITMEAIDMVMHEGMEKVRKVLGNVVPLLADCPQCGCGTAVGPEALRQLHSKK",
        "proteome": "UP000001362",
        "gene": "mtaP",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009116",
                "name": "nucleoside metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0017061",
                "name": "S-methyl-5-thioadenosine phosphorylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "27552274e8941821ae0d138350daef5fe3adde72",
        "counters": {
            "domain_architectures": 85785,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "hamap": 1,
                "ncbifam": 2,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 85785
        }
    }
}