GET /api/protein/UniProt/B7J3P1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B7J3P1",
        "id": "B7J3P1_ACIF2",
        "source_organism": {
            "taxId": "243159",
            "scientificName": "Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)",
            "fullName": "Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)"
        },
        "name": "Ribosomal RNA small subunit methyltransferase I",
        "description": [
            "Catalyzes the 2'-O-methylation of the ribose of cytidine 1402 (C1402) in 16S rRNA"
        ],
        "length": 291,
        "sequence": "MNDHAEAVEGAVGQLTIIATPIGNLDDLSPRAQRAIGAAALILVEDRRHAQRLFQHLGVQPKTLALHEHNERALAPQIARRVAAGEHIALLSDAGMPLISDPGFPLLALLREQQLPVTIIPGPNAALAALALSGLPSDRFSFEGFLPAKGGARRARILALQREPRSMIFYEAPHRISETLADMAELWGADRGAALCRELTKIYEECLRDSLGGLAALLRAHPDKVRGEMTLVVGGAPEQTLEEADADRLLGPLLAELPLAQAVRIAASQSSMAHRFLYGRALALTSGRDPV",
        "proteome": "UP000001362",
        "gene": "rsmI",
        "go_terms": [
            {
                "identifier": "GO:0008168",
                "name": "methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8ff9f165922c14c8d38e2c83a15a294f854c5971",
        "counters": {
            "domain_architectures": 10872,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "pfam": 2,
                "cdd": 1,
                "pirsf": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10872
        }
    }
}