GET /api/protein/UniProt/B7J2L5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B7J2L5",
        "id": "ERA_BORBZ",
        "source_organism": {
            "taxId": "445985",
            "scientificName": "Borreliella burgdorferi (strain ZS7)",
            "fullName": "Borreliella burgdorferi (strain ZS7)"
        },
        "name": "GTPase Era",
        "description": [
            "An essential GTPase that binds both GDP and GTP, with rapid nucleotide exchange. Plays a role in 16S rRNA processing and 30S ribosomal subunit biogenesis and possibly also in cell cycle regulation and energy metabolism"
        ],
        "length": 290,
        "sequence": "MKSGFAAILGRPSTGKSTLLNSICGHKISIISPIPQTTRNNIKGIFTDDRGQIIFIDTPGFHLSKKKFNIAMMKNIHSSIGEVELILYIIDIQDKPGEEENKMLEIIKNSKIKFLVILNKIDLKNTKIKEITQFLKEKGIEDSNIIKISAEKKINTEELKNKIYENFSEGPLYYPQEYYTDQEINFRISEIIREKAIENLKEELPYSLYVDIDTLENKKGSLFIRANIFVANESQKGIIVGKNGKEIKSIGERARKTIAKIFETKCNLFLQVKLKKNWNKEDKLIKRLIN",
        "proteome": null,
        "gene": "era",
        "go_terms": [
            {
                "identifier": "GO:0005525",
                "name": "GTP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d07fe611ffd6d32e179a8705eda9bff6c793fd7f",
        "counters": {
            "domain_architectures": 25645,
            "entries": 23,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 2,
                "cathgene3d": 2,
                "profile": 2,
                "ncbifam": 3,
                "ssf": 2,
                "pfam": 2,
                "hamap": 1,
                "panther": 1,
                "interpro": 8
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 25645
        }
    }
}