GET /api/protein/UniProt/B7J2L5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B7J2L5",
"id": "ERA_BORBZ",
"source_organism": {
"taxId": "445985",
"scientificName": "Borreliella burgdorferi (strain ZS7)",
"fullName": "Borreliella burgdorferi (strain ZS7)"
},
"name": "GTPase Era",
"description": [
"An essential GTPase that binds both GDP and GTP, with rapid nucleotide exchange. Plays a role in 16S rRNA processing and 30S ribosomal subunit biogenesis and possibly also in cell cycle regulation and energy metabolism"
],
"length": 290,
"sequence": "MKSGFAAILGRPSTGKSTLLNSICGHKISIISPIPQTTRNNIKGIFTDDRGQIIFIDTPGFHLSKKKFNIAMMKNIHSSIGEVELILYIIDIQDKPGEEENKMLEIIKNSKIKFLVILNKIDLKNTKIKEITQFLKEKGIEDSNIIKISAEKKINTEELKNKIYENFSEGPLYYPQEYYTDQEINFRISEIIREKAIENLKEELPYSLYVDIDTLENKKGSLFIRANIFVANESQKGIIVGKNGKEIKSIGERARKTIAKIFETKCNLFLQVKLKKNWNKEDKLIKRLIN",
"proteome": null,
"gene": "era",
"go_terms": [
{
"identifier": "GO:0005525",
"name": "GTP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d07fe611ffd6d32e179a8705eda9bff6c793fd7f",
"counters": {
"domain_architectures": 25645,
"entries": 23,
"isoforms": 0,
"proteomes": 0,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 2,
"cathgene3d": 2,
"profile": 2,
"ncbifam": 3,
"ssf": 2,
"pfam": 2,
"hamap": 1,
"panther": 1,
"interpro": 8
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 25645
}
}
}