GET /api/protein/UniProt/B7J0R6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B7J0R6",
"id": "MIAA_BORBZ",
"source_organism": {
"taxId": "445985",
"scientificName": "Borreliella burgdorferi (strain ZS7)",
"fullName": "Borreliella burgdorferi (strain ZS7)"
},
"name": "tRNA dimethylallyltransferase",
"description": [
"Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A)"
],
"length": 306,
"sequence": "MKEDRVVFIFGPTAVGKSNILFHFPKNKAEIINVDSIQVYKEFNIASSKPSKNLMKHIKHHLVDFLDPEKDYTIGIFYEQALKIVKEIRQKKKIPIFVGGTAFYFKHLKDGFPSTPLVTSKIRIYVNNLLELKGKSYLLKELKNVDPIRFNMLNKNDIYRIKRSLEVYYQTGIPISQFQKKQNSEFKNIVIIGLKRSFEDLKTRISIRINEMLNSGLLSEIKGLFSKGYNENTPAFKGIGYNEFLLWKSRPCYGLNDIIGLINKNSFLYAKRQMTFFAKISDVLWLHPEDDLDNILNLIFKVDKEI",
"proteome": null,
"gene": "miaA",
"go_terms": [
{
"identifier": "GO:0052381",
"name": "tRNA dimethylallyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008033",
"name": "tRNA processing",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d0384e64f9f7c69c3c37e403c75a6e4cde76f3bc",
"counters": {
"domain_architectures": 32144,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"pfam": 1,
"panther": 1,
"ncbifam": 1,
"hamap": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 32144
}
}
}