HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B7J0L8",
"id": "FLGI_BORBZ",
"source_organism": {
"taxId": "445985",
"scientificName": "Borreliella burgdorferi (strain ZS7)",
"fullName": "Borreliella burgdorferi (strain ZS7)"
},
"name": "Flagellar P-ring protein",
"description": [
"Assembles around the rod to form the L-ring and probably protects the motor/basal body from shearing forces during rotation"
],
"length": 335,
"sequence": "MNKPMLMLITFATSLLAQTNKASTGLKTDQSFNNSLSESVKLKEIADIYPTNTNFLTGIGIVAGLAGKGDSIKQKDLIIKILEENNIINEIGSNNIESKNIALVNVSLQVKGNTIKGSKHKACVASILDSKDLTNGILLKTNLKNKEGEIIAIASGITQPNNKLKGSGYTIDSVIINENQNINHSYNIILKKGNYTLINRIHKILTSKKINNKIKSDSTIEIEAKNISLLEEIENIKIETNPKILIDKKNGIILASENAKIGTFTFSIEKDNQNIFLSKNNKTTIQVNSMKLNEFILKNSNNLSNKELIQIIQAAQKINKLNGELILEEIDGNQN",
"proteome": null,
"gene": "flgI",
"go_terms": [
{
"identifier": "GO:0005198",
"name": "structural molecule activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0071973",
"name": "bacterial-type flagellum-dependent cell motility",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009428",
"name": "bacterial-type flagellum basal body, distal rod, P ring",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0030288",
"name": "outer membrane-bounded periplasmic space",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f9e9ff28661033a71a9512afc1fe3aae68d70bc5",
"counters": {
"domain_architectures": 10494,
"entries": 6,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ncbifam": 1,
"panther": 1,
"hamap": 1,
"pfam": 1,
"prints": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 10494
}
}
}