General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B7HWY8",
        "id": "LGT_BACC7",
        "source_organism": {
            "taxId": "405534",
            "scientificName": "Bacillus cereus (strain AH187)",
            "fullName": "Bacillus cereus (strain AH187)"
        },
        "name": "Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase",
        "description": [
            "Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, the first step in the formation of mature lipoproteins"
        ],
        "length": 270,
        "sequence": "MLLGSVPQLDRVAIQLGPFPVYWYGIIIGTGVLLGLWLATREGERLGIPKDTFVDLVLIAVPIAILFARMYYVIFEWEYYAQNPSQIINIRQGGLAIHGGLIGAVITGILFAKRRGVSFWKLADIAAPSILLGQAIGRWGNFMNQEAHGDEVTRQFLEGLHLPDFIINQMYIDGVYYHPTFLYESLWNFAGVILLLALRKVNLRRGELFFTYLIWYSVGRFFVEGLRTDSLMLGPLRIAQVMSIGLVVISIIFIIVRRKMGQADKRYLEN",
        "proteome": null,
        "gene": "lgt",
        "go_terms": [
            {
                "identifier": "GO:0008961",
                "name": "phosphatidylglycerol-prolipoprotein diacylglyceryl transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0042158",
                "name": "lipoprotein biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005886",
                "name": "plasma membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c5b72d4f80f7272732e2c89721c008408fadf528",
        "counters": {
            "domain_architectures": 30228,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "pfam": 1,
                "prosite": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 30228
        }
    }
}