General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B6ULW7",
        "id": "BTDD_PAPAN",
        "source_organism": {
            "taxId": "9555",
            "scientificName": "Papio anubis",
            "fullName": "Papio anubis (Olive baboon)"
        },
        "name": "Theta defensin subunit D",
        "description": [
            "BTD-7 has antimicrobial activity against the Gram-negative bacterium E.coli ML35, the Gram-positive bacterium S.aureus 502a, and the fungus C.albicans 16820"
        ],
        "length": 76,
        "sequence": "MRTFALLTAMLLLVALQAQAEARQARADEAAAQQQPGADDQGMAHSFTRPENAALPLSESAKGLRCFCRRGVCQLL",
        "proteome": "UP000028761",
        "gene": "BTDD",
        "go_terms": [
            {
                "identifier": "GO:0006952",
                "name": "defense response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005615",
                "name": "extracellular space",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "77820081f95eeed763dd087a04bc6099f75a1702",
        "counters": {
            "domain_architectures": 292,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "pfam": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 292
        }
    }
}