GET /api/protein/UniProt/B6ULW7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B6ULW7",
"id": "BTDD_PAPAN",
"source_organism": {
"taxId": "9555",
"scientificName": "Papio anubis",
"fullName": "Papio anubis (Olive baboon)"
},
"name": "Theta defensin subunit D",
"description": [
"BTD-7 has antimicrobial activity against the Gram-negative bacterium E.coli ML35, the Gram-positive bacterium S.aureus 502a, and the fungus C.albicans 16820"
],
"length": 76,
"sequence": "MRTFALLTAMLLLVALQAQAEARQARADEAAAQQQPGADDQGMAHSFTRPENAALPLSESAKGLRCFCRRGVCQLL",
"proteome": "UP000028761",
"gene": "BTDD",
"go_terms": [
{
"identifier": "GO:0006952",
"name": "defense response",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005615",
"name": "extracellular space",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "77820081f95eeed763dd087a04bc6099f75a1702",
"counters": {
"domain_architectures": 292,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"pfam": 1,
"pirsf": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 292
}
}
}