GET /api/protein/UniProt/B6QEU6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B6QEU6",
        "id": "B6QEU6_TALMQ",
        "source_organism": {
            "taxId": "441960",
            "scientificName": "Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)",
            "fullName": "Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)"
        },
        "name": "homogentisate 1,2-dioxygenase",
        "description": null,
        "length": 344,
        "sequence": "MPVTAFTSPDRYTYQNGFQSYHETEAVKGALPVGANSPQKPPYGLYAEKLSGTAFTAPRCENLQTWLYRVILAAAHSNFVPRQLDFAEDGPTKYHQIPNRLRWDPFDIDESVDWPSSLRLVAGAGGLDTITTLVAWSIGLLAQRPDIQDKAHKAIEEFYSTKQPLCDALEDQRCKYIVALVREFLTYYTVLRDIEYNGVQIPKGSIFFLSAWACNMGKSVRAVYGYLVFLLRIVAYLDDNVWEDPEVFRPERWFEQDDAPFFTYGMGYRMCAGSLLANRELYLIFMRLINSFKIEKEIEFDAHPVSGNMDPTSLVAMPKKYYARFVPRDEAALRGALKEFEVVE",
        "proteome": "UP000001294",
        "gene": "PMAA_080510",
        "go_terms": [
            {
                "identifier": "GO:0004497",
                "name": "monooxygenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005506",
                "name": "iron ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016705",
                "name": "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0020037",
                "name": "heme binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004411",
                "name": "homogentisate 1,2-dioxygenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006559",
                "name": "L-phenylalanine catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006570",
                "name": "tyrosine metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4363d7f98ac5ce49ecd42a9f420cb22942cd8225",
        "counters": {
            "domain_architectures": 1,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "pfam": 2,
                "cathgene3d": 1,
                "panther": 1,
                "prints": 2,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1
        }
    }
}