HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B6Q207",
"id": "B6Q207_TALMQ",
"source_organism": {
"taxId": "441960",
"scientificName": "Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)",
"fullName": "Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)"
},
"name": "Protein transport protein SEC22",
"description": null,
"length": 215,
"sequence": "MVRSTQIARLDGLMLAASVDDEQAENELAQVKSQSKMIFRRLSRNAAPEASIESGQYTLHYIIKDDVCFLCICDKSYPRKLAFTYLADIATEFTTTYSSQQYNSPNLRPYAFVEFDTFIQRTKGTYQNSRAAANLDKLNDELRDVTKVMTKNIEDLLYRGDSLERMGEMSGRLREDSMKYRKAAVYINWQLLAKQYGPFAGVGFIMLIFIWWRFF",
"proteome": "UP000001294",
"gene": "PMAA_018040",
"go_terms": [
{
"identifier": "GO:0005484",
"name": "SNAP receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006888",
"name": "endoplasmic reticulum to Golgi vesicle-mediated transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006890",
"name": "retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e09a1477707fd7f9badcb09d6cf1d43f3f6a69d9",
"counters": {
"domain_architectures": 17217,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 2,
"cdd": 2,
"profile": 2,
"smart": 1,
"pfam": 2,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 17217
}
}
}