General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B6IR09",
        "id": "B6IR09_RHOCS",
        "source_organism": {
            "taxId": "414684",
            "scientificName": "Rhodospirillum centenum (strain ATCC 51521 / SW)",
            "fullName": "Rhodospirillum centenum (strain ATCC 51521 / SW)"
        },
        "name": "Chaperone NapD",
        "description": [
            "Chaperone for NapA, the catalytic subunit of the periplasmic nitrate reductase. It binds directly and specifically to the twin-arginine signal peptide of NapA, preventing premature interaction with the Tat translocase and premature export"
        ],
        "length": 95,
        "sequence": "MGPEDIGELHIASLLVQRDPGQAGMVRDGLAGVPGAELQIEEGAKAIVTVEGASAGDIAEALTRIQLLPGVMSAVMVFHHQEAGEPDGGAERGVP",
        "proteome": "UP000001591",
        "gene": "napD",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cf776605ff36c65548fdc5ce6bdd33b93d45d007",
        "counters": {
            "domain_architectures": 3139,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "hamap": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3139
        }
    }
}