GET /api/protein/UniProt/B6IBB8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B6IBB8",
"id": "SUFE_ECOSE",
"source_organism": {
"taxId": "409438",
"scientificName": "Escherichia coli (strain SE11)",
"fullName": "Escherichia coli (strain SE11)"
},
"name": "Cysteine desulfuration protein SufE",
"description": [
"Participates in cysteine desulfuration mediated by SufS. Cysteine desulfuration mobilizes sulfur from L-cysteine to yield L-alanine and constitutes an essential step in sulfur metabolism for biosynthesis of a variety of sulfur-containing biomolecules. Functions as a sulfur acceptor for SufS, by mediating the direct transfer of the sulfur atom from the S-sulfanylcysteine of SufS, an intermediate product of cysteine desulfuration process"
],
"length": 138,
"sequence": "MALLPDKEKLLRNFLRCANWEEKYLYIIELGQRLPELRAEDRSPQNSIQGCQSQVWIVMRQNAQGIIELQGDSDAAIVKGLIAVVFILYDQMTPQDIVNFDVRPWFEKMALTQHLTPSRSQGLEAMIRAIRAKAAALS",
"proteome": null,
"gene": "sufE",
"go_terms": [
{
"identifier": "GO:0006790",
"name": "sulfur compound metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016226",
"name": "iron-sulfur cluster assembly",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "63ee8909197e2fa1f639e2794c848f778d79cfb7",
"counters": {
"domain_architectures": 14137,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"ncbifam": 1,
"hamap": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 14137
}
}
}