GET /api/protein/UniProt/B6I829/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B6I829",
"id": "COBS_ECOSE",
"source_organism": {
"taxId": "409438",
"scientificName": "Escherichia coli (strain SE11)",
"fullName": "Escherichia coli (strain SE11)"
},
"name": "Adenosylcobinamide-GDP ribazoletransferase",
"description": [
"Joins adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). Also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate"
],
"length": 247,
"sequence": "MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCGVPLAALFSVLVLALMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFVVLAKILVLSELALRGEPILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQTCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGELVFLLALL",
"proteome": null,
"gene": "cobS",
"go_terms": [
{
"identifier": "GO:0008818",
"name": "cobalamin 5'-phosphate synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051073",
"name": "adenosylcobinamide-GDP ribazoletransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "273e5485534238ffd63b6cd13298072b219ea626",
"counters": {
"domain_architectures": 15762,
"entries": 5,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ncbifam": 1,
"hamap": 1,
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 15762
}
}
}