GET /api/protein/UniProt/B6I2A3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B6I2A3",
"id": "ULAF_ECOSE",
"source_organism": {
"taxId": "409438",
"scientificName": "Escherichia coli (strain SE11)",
"fullName": "Escherichia coli (strain SE11)"
},
"name": "L-ribulose-5-phosphate 4-epimerase UlaF",
"description": [
"Catalyzes the isomerization of L-ribulose 5-phosphate to D-xylulose 5-phosphate. Is involved in the anaerobic L-ascorbate utilization"
],
"length": 228,
"sequence": "MLKLKQQVFEANMDLPRYGLVTFTWGNVSAIDRERGLVVIKPSGVAYETMKADDMVVVDMSGKVVEGEYRPSSDTATHLELYRRYPSLGGIVHTHSTHATAWAQAGLAIPALGTTHADYFFGDIPCTRGLSEEEVQGEYELNTGKVIIETLGNAEPLHTPGIVVYQHGPFAWGKDAHDAVHNAVVMEEVAKMAWIARGINPQLNHIDSFLMNKHFMRKHGPNAYYGQK",
"proteome": null,
"gene": "ulaF",
"go_terms": [
{
"identifier": "GO:0008742",
"name": "L-ribulose-phosphate 4-epimerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "88b5949af4437eee368b582b7bd45779a910fc07",
"counters": {
"domain_architectures": 64096,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"pfam": 1,
"smart": 1,
"hamap": 1,
"ncbifam": 2,
"panther": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 64096
}
}
}