General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B6HGW6",
        "id": "B6HGW6_PENRW",
        "source_organism": {
            "taxId": "500485",
            "scientificName": "Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)",
            "fullName": "Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)"
        },
        "name": "Nascent polypeptide-associated complex subunit alpha",
        "description": [
            "Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation"
        ],
        "length": 203,
        "sequence": "MADPRVEEIHDDDVSKTVEESSSESGSEAGDEPNIPAGASVAVHSRGEKKARKAIGKLGLKLVPGITRVTLRRPKNILFVVNQPEVYRSPNSNCWIIFGEAKIEDLNSQAQASAAQQLAASEATGDHAGHDHEEEVLGKAKAPEAEDKKEDEEDDGEEVDESNLESKDIELVMAQANVSRKKAVKALRENDNDIVNSIMALSI",
        "proteome": "UP000000724",
        "gene": "Pc20g13270",
        "go_terms": [
            {
                "identifier": "GO:0005854",
                "name": "nascent polypeptide-associated complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b32d432ecaec19a21454389a2ec7a6751b953bcf",
        "counters": {
            "domain_architectures": 7193,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "smart": 1,
                "cdd": 2,
                "cathgene3d": 2,
                "pfam": 2,
                "panther": 1,
                "pirsf": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7193
        }
    }
}