General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B6DUH1",
        "id": "B6DUH1_9TELE",
        "source_organism": {
            "taxId": "351240",
            "scientificName": "Hemibarbus mylodon",
            "fullName": "Hemibarbus mylodon (Korean doty barbel)"
        },
        "name": "Apolipoprotein E-2",
        "description": [
            "APOE is an apolipoprotein, a protein associating with lipid particles, that mainly functions in lipoprotein-mediated lipid transport between organs via the plasma and interstitial fluids. APOE is a core component of plasma lipoproteins and is involved in their production, conversion and clearance. Apolipoproteins are amphipathic molecules that interact both with lipids of the lipoprotein particle core and the aqueous environment of the plasma"
        ],
        "length": 281,
        "sequence": "MRSLVVFFALSVFTGCHARSLFQADAPQPRWEEMVDRFWQSVSELNSHADGVVXNIKGSQLSRELDTLITDTMAELNSYSDNLQTQLTPYASDAAGQLTKDIQLLAGKLQTDMTDAKERSTQYLQELKTMVEQNADDVKNRVNTYTRKLKKRLNKDTEEIRNTVATYLGELQSRASQNADAVKDRLEPYLTQAQDGANQKLGAISELMKSQAQEMGEQLEVQAGALKEKLEQTAEELRTSLEGRVDELTSLLTPYSEKIREQLKIVMDKIKEASAALPTQA",
        "proteome": null,
        "gene": "apoE-2",
        "go_terms": [
            {
                "identifier": "GO:0008289",
                "name": "lipid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006869",
                "name": "lipid transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0042157",
                "name": "lipoprotein metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "0f689dbae454f053963913a5f4bb471330d88593",
        "counters": {
            "domain_architectures": 3600,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 2,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 3600
        }
    }
}