GET /api/protein/UniProt/B5ZMN6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B5ZMN6",
        "id": "UREF_RHILW",
        "source_organism": {
            "taxId": "395492",
            "scientificName": "Rhizobium leguminosarum bv. trifolii (strain WSM2304)",
            "fullName": "Rhizobium leguminosarum bv. trifolii (strain WSM2304)"
        },
        "name": "Urease accessory protein UreF",
        "description": [
            "Required for maturation of urease via the functional incorporation of the urease nickel metallocenter"
        ],
        "length": 223,
        "sequence": "MTGDRELQALLRLTAWLSPAFPVGSFAYSGGLERAVADGLVTDAVSLAAWIGTLIGYGSVWNDAVLLAESHRWQAEPARLFEIAALAEALAGSRERHQETMLLGDAFLTAARAWPDGVFERLPDKAAYPVAVGAVTGAHGIGPEKALAVFLHAYASQAVSSGIRLGVTGQRDGVAVLAGLEECITEVARRAAASTLDDLGSATVQADIAGLRHETQATRLFRS",
        "proteome": "UP000008330",
        "gene": "ureF",
        "go_terms": [
            {
                "identifier": "GO:0016151",
                "name": "nickel cation binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e9a4d4a372b3a67c867d95da42c4dd3e15eb301b",
        "counters": {
            "domain_architectures": 12960,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pirsf": 1,
                "panther": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 12960
        }
    }
}