GET /api/protein/UniProt/B5Z9F8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B5Z9F8",
"id": "NADK_HELPG",
"source_organism": {
"taxId": "563041",
"scientificName": "Helicobacter pylori (strain G27)",
"fullName": "Helicobacter pylori (strain G27)"
},
"name": "NAD kinase",
"description": [
"Involved in the regulation of the intracellular balance of NAD and NADP, and is a key enzyme in the biosynthesis of NADP. Catalyzes specifically the phosphorylation on 2'-hydroxyl of the adenosine moiety of NAD to yield NADP"
],
"length": 284,
"sequence": "MKDSHQTIGVFVRPTHYQNPLFEELERAKEWVLKLLEDEGFESFMIDSLDGAQDERLIEKAYAFLCLGGDGTILGALRMTHSYNKPCFGVRIGNLGFLSAVELNGLKDFLQDLKQDRIKLEEHLALEGRIGKISFYAINEIVIAKKKALGVLDIKAYAGHTPFNTYKGDGLIIATPLGSTAYNLSAHGPIVHALSQSYILTPLCDFSLTQRPLVLGAEFCLNFCAHEDALVVIDGQATYDLKANQPLYIQKSPTTTKLLQKNSRDYFKVLKEKLLWGESPSKKR",
"proteome": "UP000001735",
"gene": "nadK",
"go_terms": [
{
"identifier": "GO:0006741",
"name": "NADP+ biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0019674",
"name": "NAD+ metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6dbe0777d1dd1f485df8c8f35d32e1628c1f7845",
"counters": {
"domain_architectures": 35208,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 2,
"pfam": 2,
"hamap": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 35208
}
}
}