GET /api/protein/UniProt/B5Z9F8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B5Z9F8",
        "id": "NADK_HELPG",
        "source_organism": {
            "taxId": "563041",
            "scientificName": "Helicobacter pylori (strain G27)",
            "fullName": "Helicobacter pylori (strain G27)"
        },
        "name": "NAD kinase",
        "description": [
            "Involved in the regulation of the intracellular balance of NAD and NADP, and is a key enzyme in the biosynthesis of NADP. Catalyzes specifically the phosphorylation on 2'-hydroxyl of the adenosine moiety of NAD to yield NADP"
        ],
        "length": 284,
        "sequence": "MKDSHQTIGVFVRPTHYQNPLFEELERAKEWVLKLLEDEGFESFMIDSLDGAQDERLIEKAYAFLCLGGDGTILGALRMTHSYNKPCFGVRIGNLGFLSAVELNGLKDFLQDLKQDRIKLEEHLALEGRIGKISFYAINEIVIAKKKALGVLDIKAYAGHTPFNTYKGDGLIIATPLGSTAYNLSAHGPIVHALSQSYILTPLCDFSLTQRPLVLGAEFCLNFCAHEDALVVIDGQATYDLKANQPLYIQKSPTTTKLLQKNSRDYFKVLKEKLLWGESPSKKR",
        "proteome": "UP000001735",
        "gene": "nadK",
        "go_terms": [
            {
                "identifier": "GO:0006741",
                "name": "NADP+ biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0019674",
                "name": "NAD+ metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6dbe0777d1dd1f485df8c8f35d32e1628c1f7845",
        "counters": {
            "domain_architectures": 35208,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "pfam": 2,
                "hamap": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 35208
        }
    }
}