GET /api/protein/UniProt/B5XBN8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B5XBN8",
        "id": "B5XBN8_SALSA",
        "source_organism": {
            "taxId": "8030",
            "scientificName": "Salmo salar",
            "fullName": "Salmo salar (Atlantic salmon)"
        },
        "name": "Radial spoke head 1 homolog",
        "description": [
            "Functions as part of axonemal radial spoke complexes that play an important part in the motility of sperm and cilia"
        ],
        "length": 248,
        "sequence": "MSDVGSEDFDDDQGYLGEYEGDRNEAGERHGVGRAVLPNGDTYQGMYENGKRSGQGTYRFKNGARYIGEYYQNLKHGHGIFYYPDGSKYEGSWVDDQRQGHGLYTYPNQDTYEGEWLHHQRNGQGIYHYNDTGSRYMGTWVMGKMESAGEFIHLNHRYQGNFLNNNPSGPGKYVFEIGCEQHGEYLQVDQDRADADEDDIVSTMVLKWKPKAVTGLSLWTPAKDPSSDGEGLASADEKGGSEPPAPET",
        "proteome": "UP001652741",
        "gene": "RSPH1",
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "dbc1154d2903d0f38235e443dc6fc58d7d8abb26",
        "counters": {
            "domain_architectures": 5489,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5489
        }
    }
}