GET /api/protein/UniProt/B5XBN8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B5XBN8",
"id": "B5XBN8_SALSA",
"source_organism": {
"taxId": "8030",
"scientificName": "Salmo salar",
"fullName": "Salmo salar (Atlantic salmon)"
},
"name": "Radial spoke head 1 homolog",
"description": [
"Functions as part of axonemal radial spoke complexes that play an important part in the motility of sperm and cilia"
],
"length": 248,
"sequence": "MSDVGSEDFDDDQGYLGEYEGDRNEAGERHGVGRAVLPNGDTYQGMYENGKRSGQGTYRFKNGARYIGEYYQNLKHGHGIFYYPDGSKYEGSWVDDQRQGHGLYTYPNQDTYEGEWLHHQRNGQGIYHYNDTGSRYMGTWVMGKMESAGEFIHLNHRYQGNFLNNNPSGPGKYVFEIGCEQHGEYLQVDQDRADADEDDIVSTMVLKWKPKAVTGLSLWTPAKDPSSDGEGLASADEKGGSEPPAPET",
"proteome": "UP001652741",
"gene": "RSPH1",
"go_terms": null,
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "dbc1154d2903d0f38235e443dc6fc58d7d8abb26",
"counters": {
"domain_architectures": 5489,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5489
}
}
}