General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B5X2N1",
        "id": "B5X2N1_SALSA",
        "source_organism": {
            "taxId": "8030",
            "scientificName": "Salmo salar",
            "fullName": "Salmo salar (Atlantic salmon)"
        },
        "name": "Formylglycine-generating enzyme",
        "description": [
            "Oxidase that catalyzes the conversion of cysteine to 3-oxoalanine on target proteins, using molecular oxygen and an unidentified reducing agent. 3-oxoalanine modification, which is also named formylglycine (fGly), occurs in the maturation of arylsulfatases and some alkaline phosphatases that use the hydrated form of 3-oxoalanine as a catalytic nucleophile. Known substrates include GALNS, ARSA, STS and ARSE"
        ],
        "length": 378,
        "sequence": "MLLYCVFFLFYLNVKDDVLCVQSKPGLSVGVEPETIVPLAAESSSCGCHNLKRDAVVDIEKESSIITENPSVKYSKKSNERHTDTQTNGEESDTRSQMVLIPGGEFLMGTDNPGIPQDGEGPQRRVHLDHFYMDAHEVSNRHFQSFINATGYITEAERFGDSFVFEGVLSEEVKSQISQAVAAAPWWLPVRGADWRHPEGPDSSITGRLDHPVLHVSWQDAVAYCSWAHKRLPTEAEWEYACRGGLQDRLYPWGNKLKPKGQHYANLWQGKFPTHNSEEDGYTKTSPVKSFPANGYGLYNMVGNAWEWTSDWWTVHHTTDERHNPAGPPSGTDRVKKGGSYMCHKSYCYRYRCAARSQNTPDSSASNLGFRCVSQEQP",
        "proteome": "UP001652741",
        "gene": "SUMF1",
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "bc494af704c2f78f1f23f429e1302fc2d52ae366",
        "counters": {
            "domain_architectures": 32677,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 32677
        }
    }
}