HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B5W8J7",
"id": "B5W8J7_LIMMA",
"source_organism": {
"taxId": "513049",
"scientificName": "Limnospira maxima CS-328",
"fullName": "Limnospira maxima CS-328"
},
"name": "Photosystem II protein D1",
"description": [
"Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII as well as several subsequent electron acceptors"
],
"length": 359,
"sequence": "MTTTLQQRENLNVWEQFCTWVTSTNNRLYVGWFGIVMIPTLLTATICFVLAFVAAPPVDIDGIREPVSGSLLYGNNIITAAVVPSSNAIGLHFYPIWEAANIDEWLYNGGPYQLIVFHFLIGIFCYMGREWELSYRLGMRPWIAVAYSAPVAAATAVLLVYSIGQGSFSDGLPLGISGTFNFMLVLQAEHNVLMHPFHMLGVAGVFGGALFSAMHGSLVTSSLVRETTEIESQNRGYRFGQEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLGAWPVVGIWFASLAVACFAFNLNGFNFNHSVLDSQGQVLNTWADVINRANLGIEAMHERNVHNFPLDLASTESKPVNLVAPNIG",
"proteome": "UP000004061",
"gene": "psbA",
"go_terms": [
{
"identifier": "GO:0009772",
"name": "photosynthetic electron transport in photosystem II",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0019684",
"name": "photosynthesis, light reaction",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009055",
"name": "electron transfer activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "73c30af4df54cc5ea0296573b55812fd28876e62",
"counters": {
"domain_architectures": 46410,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"pfam": 1,
"prosite": 1,
"prints": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 46410
}
}
}