GET /api/protein/UniProt/B5VL27/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B5VL27",
        "id": "CIS3_YEAS6",
        "source_organism": {
            "taxId": "545124",
            "scientificName": "Saccharomyces cerevisiae (strain AWRI1631)",
            "fullName": "Saccharomyces cerevisiae (strain AWRI1631) (Baker's yeast)"
        },
        "name": "Cell wall mannoprotein CIS3",
        "description": [
            "Component of the outer cell wall layer. Required for stability of the cell wall and for optimal growth. Required for resistance against several antifungal and cell wall-perturbing agents (By similarity)"
        ],
        "length": 225,
        "sequence": "MQFKNVALAASVAALSATASAEGYTPGEPWSTLTPTGSISCGAAEYTTTFGIAVQAITSSKAKRDVISQIGDGQVQATSAAATDSQVQASSTATPTSSEKISSSASKTSSTNATSSSCATPSLKDSSCKNSGTLELTLKDGVLTDAKGRIGSIVANRQFQFDGPPPQAGAIYAAGWSITEDGYLALGDSDVFYQCLSGNFYNLYDQNVAEQCSAIHLEAVSLVDC",
        "proteome": null,
        "gene": "CIS3",
        "go_terms": [
            {
                "identifier": "GO:0005199",
                "name": "structural constituent of cell wall",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005618",
                "name": "cell wall",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ee5cf2ba343c0c89000ad06bc658131ce73e12f9",
        "counters": {
            "domain_architectures": 77,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "pfam": 2,
                "panther": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 77
        }
    }
}