HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B5S048",
"id": "B5S048_RALSL",
"source_organism": {
"taxId": "305",
"scientificName": "Ralstonia solanacearum",
"fullName": "Ralstonia solanacearum"
},
"name": "Large ribosomal subunit protein uL22",
"description": [
"The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome",
"This protein binds specifically to 23S rRNA; its binding is stimulated by other ribosomal proteins, e.g., L4, L17, and L20. It is important during the early stages of 50S assembly. It makes multiple contacts with different domains of the 23S rRNA in the assembled 50S subunit and ribosome"
],
"length": 109,
"sequence": "MEVKAIHRGARISAQKTRLVADQIRGLPIERALNVLTFSPKKAAGIVKKVVESAIANAEHNEGADIDELKVKSIYIDKATSLKRFTARAKGRGNRIEKQTCHITVTLGN",
"proteome": null,
"gene": "rplV",
"go_terms": [
{
"identifier": "GO:0003735",
"name": "structural constituent of ribosome",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006412",
"name": "translation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005840",
"name": "ribosome",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0015934",
"name": "large ribosomal subunit",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c33fece06d00a2e6902b8b7efbe7e3e414e72fb4",
"counters": {
"domain_architectures": 49125,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 49125
}
}
}